|
|
Recombinant human UBA1(Ubiquitin-activating enzyme E1)
Catalog # : EPX-011-REP
Source : Human
Expressed in : SF9 cells
Quantity : 5 µg of recombinant human UBA1 at 0.05µg /µl
Background:
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP.
Protein details:
Recombinant human N-terminal His tagged UBA1 was produced in Baculovirus, purified using FPLC and formulated in a storage buffer containing 20 mM Tris pH 7.65, 150 mM NaCl, 1 mM DTT, 10% glycerol. Protein concentration was determined by spectrometry. >95% purity by SDS-PAGE.
Quality control:
Each lot has been evaluated by 10% Tris Glycine SDS-PAGE.
In vitro glycosylase assay:
A 70 bp DNA containing a G/T mismatch was
incubated or not
with recombinant MBD4 for 30 minutes at 37°C. The reaction products
were treated with NaOH and run on PAGE under denaturing conditions.
Note that a 35 bp cut product was generated in the presence of MBD4.
Storage:
-80°C
Guarantee:
For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.
Sequence:
UBA1 (Mw: 118,789 Da.)
MIHHHHHHSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLY
|
|---|