|  | Recombinant mouse TDG
 Catalog # : EPX-003-RBV 
 Source : Mouse 
 Expressed in : SF9 cells 
 Quantity : 10µg of enzymatically active recombinant TDG at 0.5µg /µl 
 
 
 Background: 
 TDG is a G/T mismatch-specific thymine-DNA glycosylase (1, 2). In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs (3). It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine (3). In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. 
 
 Protein details: 
 Recombinant mouse N-terminal His tagged TDG was produced in SF9 insect cells, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.6, 1mM EDTA, 0.15 M NaCl, 10% glycerol, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry. >95% purity by SDS-PAGE. 
 
 Quality control: 
 
 
 
 
 In vitro glycosylase assay: 
 A  70 bp DNA containing a G/T mismatch was
incubated or not
with recombinant MBD4 for 30 minutes at 37°C. The reaction products
were treated with NaOH and run on PAGE under denaturing conditions.
Note that a 35 bp cut product was generated in the presence of MBD4.  
 
 Storage: 
 -80°C 
 
 Guarantee: 
 For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly. 
 
 Purity: 
 >98% purity by SDS PAGE. 
 
 Sequence: 
 MGSSHHHHHHSSGLVPRGSHMLEPGGMDAEAARSYSLEQVQALYSFPFQQ 
 References: 1.    Neddermann and Jiricny.
J. Biol. Chem. 268:21218-21224(1993) | 
|---|