Recombinant H3.1 core Histones

 

Catalog # : EPX-03-RH

 

Source : Human

 

Expressed in : E. Coli

 

Quantity : 25ug of recombinant core histones at 1ug /ul

 

 

 

Background:

 

Histones are the core components of the nucleosome (1). The nucleosome is the basic subunit of chromatin and consists of 147 base pairs of DNA wrapped around an octamer of core histones H2A, H2B, H3 and H4 (2).

 

 

Protein details:

 

Recombinant human core histones produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.9, 1mM EDTA, 2M NaCl, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry.

 

 

Quality control:

 

Each lot has been evaluated by ESI-TOF analysis and 14% SDS-PAGE mini-gel (NOVEX Tris-Glycine SDS, Invitrogen).

 

center  

SDS-PAGE gel of human core Histones.

2ug of recombinant core histones (lane 3) compared with native core histones extracted from HELA cells (lane 2). Lane 1, protein molecular weight marker.

  ESi-TOF analysis of recombinant human H3.1 core histones.

 

Application Notes:

 

For research use only.

 

 

Storage:

 

-80C

 

 

Guarantee:

 

Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Protein sequences:

H2A (Theoretical Mw: 14091.48)

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGA

PVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK

LLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

 

H2B (Theoretical Mw: 13904.17)

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQ

VHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQ

TAVRLLLPGELAKHAVSEGTKAVTKYTSAK

 

H3.1 (Theoretical Mw: 15404.09)

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALR

EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY

LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

 

H4 (Theoretical Mw: 11367.34)

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRIS

GLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR

TLYGFGG

 

References:

1. Van Holde, K. E. (1989) Chromatin, 1-497.

2. Luger et al., (1997) Nature, 389(6648):251-60..

 

 

 


2011-2016 EpiGex. All rights reserved